Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein secG (secG)

This Recombinant Probable protein-export membrane protein secG (secG) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein secG

UniProt

P51274

Expression Region

1-71

Origin

Porphyra purpurea

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQILKFLWYISTIILVFSILIHNPKSEGLGTIGSQNQFFSNTRSTENTLNKVTWLFLAL FLLFTTILAIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREM Rabbit Polyclonal Antibody (BF750)
orb1600778 100 µL

CREM Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
OAC-1
sc-397046A 25 mg

OAC-1

Sign In for Pricing
View Details
Syngap1 3'UTR Lenti-reporter-Luc Vector
45968084 1.0 µg

Syngap1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
GATA6, Phosphorylated (Y271) (GATA6, Transcription factor GATA-6, GATA-binding factor 6) (MaxLight 750)
MBS6301344-01 0.1 mL

GATA6, Phosphorylated (Y271) (GATA6, Transcription factor GATA-6, GATA-binding factor 6) (MaxLight 750)

Sign In for Pricing
View Details
GATA6, Phosphorylated (Y271) (GATA6, Transcription factor GATA-6, GATA-binding factor 6) (MaxLight 750)
MBS6301344-02 5x 0.1 mL

GATA6, Phosphorylated (Y271) (GATA6, Transcription factor GATA-6, GATA-binding factor 6) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 2 (APRL2)
orb2927638-01 20 µg

Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 2 (APRL2)

Sign In for Pricing
View Details