Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein secG (secG)

This Recombinant Probable protein-export membrane protein secG (secG) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein secG

UniProt

P51274

Expression Region

1-71

Origin

Porphyra purpurea

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQILKFLWYISTIILVFSILIHNPKSEGLGTIGSQNQFFSNTRSTENTLNKVTWLFLAL FLLFTTILAIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf168 sgRNA CRISPR Lentivector set (Human)
K0215201 3x 1.0 µg

C1orf168 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ZNF223 Human Gene Knockout Kit (CRISPR)
KN405237 1 Kit

ZNF223 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Coagulation Factor IX ELISA Kit (F9)
RK01344 96 Tests

Human Coagulation Factor IX ELISA Kit (F9)

Sign In for Pricing
View Details
AANAT discontinued
385113 200 µL

AANAT discontinued

Sign In for Pricing
View Details
PRR29 (NM_001191029) Human Tagged ORF Clone Lentiviral Particle
RC231083L4V 200 µL

PRR29 (NM_001191029) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GAS41 Rabbit pAb
MBS8597281-01 0.1 mL

GAS41 Rabbit pAb

Sign In for Pricing
View Details