Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein secG (secG)

This Recombinant Probable protein-export membrane protein secG (secG) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein secG

UniProt

P51274

Expression Region

1-71

Origin

Porphyra purpurea

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQILKFLWYISTIILVFSILIHNPKSEGLGTIGSQNQFFSNTRSTENTLNKVTWLFLAL FLLFTTILAIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal HSP90B1 / GP96 / GRP94 Antibody (aa211-260)
APR07816G 0.05ml

Polyclonal HSP90B1 / GP96 / GRP94 Antibody (aa211-260)

Sign In for Pricing
View Details
Tmem185b (NM_146103) Mouse Tagged ORF Clone
MR205296 10 µg

Tmem185b (NM_146103) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Camel Plakophilin 1 ELISA Kit
MBS102811-01 48 Well

Camel Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details
Camel Plakophilin 1 ELISA Kit
MBS102811-02 96 Well

Camel Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details
Camel Plakophilin 1 ELISA Kit
MBS102811-03 5x 96 Well

Camel Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details
Camel Plakophilin 1 ELISA Kit
MBS102811-04 10x 96 Well

Camel Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details