Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit c 1 (atpE1)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit c 1 (atpE1) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c 1, ATP synthase F (0) sector subunit c 1, F-type ATPase subunit c 1, F-ATPase subunit c 1, Lipid-binding protein 1

UniProt

A3PN84

Expression Region

1-71

Origin

Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFAEALGIFS FLIALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: B-A11]
AM31224AF-N 200 µg

CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: B-A11]

Sign In for Pricing
View Details
Polystyrene A COOH
HA110003.100G 100 g

Polystyrene A COOH

Sign In for Pricing
View Details
CCNDBP1 Human Gene Knockout Kit (CRISPR)
KN402006 1 Kit

CCNDBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EIF4E pSer209 Rabbit Polyclonal Antibody
AP02491PU-N 100 µL

EIF4E pSer209 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Khdc4 Mouse Gene Knockout Kit (CRISPR)
KN500297 1 Kit

Khdc4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF740 conjugate, 0.1mg/mL
BNC740907-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details