Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium beijerinckii ATP synthase subunit c (atpE)

This Recombinant Clostridium beijerinckii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A6LQH1

Expression Region

1-71

Origin

Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVLAAGIAVLSGIGAGVGIGIAAGKAVEAVGRQPEASGRVMTFFILGAALCETTAIY GLVMAFMLMGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL
BNC881960-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tal1 (BTL73), CF568 conjugate, 0.1mg/mL
BNC682852-500 1x 500 µL

Tal1 (BTL73), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-A (VEGF/1063), CF640R conjugate, 0.1mg/mL
BNC401063-500 1x 500 µL

VEGF-A (VEGF/1063), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details