Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2TJZ5

Expression Region

1-71

Origin

Clostridium botulinum (strain Eklund 17B / Type B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLAVIGAGIAVLTGLGAGIGIGIATGRATEAIARQPEAASKIQTALIIGAGLAEATAIY GLIIAFMILTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-trans-4-hydroxy-D-proline
TRC-B284940-500MG 500 mg

Boc-trans-4-hydroxy-D-proline

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703866 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
HSD17B1 Rabbit Monoclonal Antibody [Clone ID: OTIR1E5]
TA594454S 30 µL

HSD17B1 Rabbit Monoclonal Antibody [Clone ID: OTIR1E5]

Sign In for Pricing
View Details
DDX59 (NM_001031725) Human Over-expression Lysate
LC422174 20 µg

DDX59 (NM_001031725) Human Over-expression Lysate

Sign In for Pricing
View Details
L-Norleucine-d9
TRC-N712002-1MG 1 mg

L-Norleucine-d9

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), Biotin conjugate, 0.1mg/mL
BNCB0732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details