Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Micrococcus luteus ATP synthase subunit c (atpE)

This Recombinant Micrococcus luteus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C5CA73

Expression Region

1-71

Origin

Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHGSLNMIGYGLAAIGSAIGVGLIFAAYINGVARQPEAQRILQPIALLGFALAEALAI LGLVFAFVIGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody
abx275187-01 50 Tests

Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody

Sign In for Pricing
View Details
Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody
abx275187-02 100 Tests

Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody

Sign In for Pricing
View Details
Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody
abx275187-03 200 Tests

Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody

Sign In for Pricing
View Details
Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody
abx275187-04 500 Tests

Serine / Threonine-Protein Kinase DCLK1 (DCLK1) Antibody

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, Homeo box 1C, Homeo box A5, Homeobox Protein HOXA5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 405)
MBS6194162-01 0.1 mL

HOXA5 (Homeobox A5, Homeo box 1C, Homeo box A5, Homeobox Protein HOXA5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 405)

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, Homeo box 1C, Homeo box A5, Homeobox Protein HOXA5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 405)
MBS6194162-02 5x 0.1 mL

HOXA5 (Homeobox A5, Homeo box 1C, Homeo box A5, Homeobox Protein HOXA5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 405)

Sign In for Pricing
View Details