Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Micrococcus luteus ATP synthase subunit c (atpE)

This Recombinant Micrococcus luteus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C5CA73

Expression Region

1-71

Origin

Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHGSLNMIGYGLAAIGSAIGVGLIFAAYINGVARQPEAQRILQPIALLGFALAEALAI LGLVFAFVIGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr464 Protein Vector (Rat) (pPM-C-His)
PV290133 500 ng

Olr464 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
MORN1 Protein Vector (Human) (pPB-N-His)
PV026306 500 ng

MORN1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse GDF15 (Growth Differentiation Factor 15) Microsample ELISA Kit
orb2998017-01 48 Tests

Mouse GDF15 (Growth Differentiation Factor 15) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse GDF15 (Growth Differentiation Factor 15) Microsample ELISA Kit
orb2998017-02 96 Tests

Mouse GDF15 (Growth Differentiation Factor 15) Microsample ELISA Kit

Sign In for Pricing
View Details
SHIP2(Phospho-Tyr1135) Rabbit Polyclonal Antibody
JOT-AP04729-01 20 µL

SHIP2(Phospho-Tyr1135) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SHIP2(Phospho-Tyr1135) Rabbit Polyclonal Antibody
JOT-AP04729-02 50 μL

SHIP2(Phospho-Tyr1135) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details