Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein secG (secG)

This Recombinant Probable protein-export membrane protein secG (secG) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein secG

UniProt

Q1XDL2

Expression Region

1-71

Origin

Porphyra yezoensis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQILKFFWYSSTIILIFTILIHNPKSEGLGSVGAQNQFFSNTRSTENTLNKITWLFLVL FLLLTTIIAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF37 Human Gene Knockout Kit (CRISPR)
KN417628 1 Kit

ARHGEF37 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF405S conjugate, 0.1mg/mL
BNC041909-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Azilsartan Hydroxy Acid
TRC-A926930-50MG 50 mg

Azilsartan Hydroxy Acid

Sign In for Pricing
View Details
ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]
TA501216AM 100 µL

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]

Sign In for Pricing
View Details
2,2'-Dithiobisbenzoic Acid
TRC-D493990-25G 25 g

2,2'-Dithiobisbenzoic Acid

Sign In for Pricing
View Details
S100 beta Recombinant Chimeric Antibody Antibody
HA610365 100 µL

S100 beta Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details