Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein secG (secG)

This Recombinant Probable protein-export membrane protein secG (secG) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein secG

UniProt

Q1XDL2

Expression Region

1-71

Origin

Porphyra yezoensis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQILKFFWYSSTIILIFTILIHNPKSEGLGSVGAQNQFFSNTRSTENTLNKITWLFLVL FLLLTTIIAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpsf2 Mouse Gene Knockout Kit (CRISPR)
KN503776 1 Kit

Cpsf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CHADL activation kit by CRISPRa
GA115747 1 Kit

Human CHADL activation kit by CRISPRa

Sign In for Pricing
View Details
OTX2 (NM_021728) Human Recombinant Protein
TP760159 50 µg

OTX2 (NM_021728) Human Recombinant Protein

Sign In for Pricing
View Details
(+)-Strigolactone GR24
TRC-S687600-25MG 25 mg

(+)-Strigolactone GR24

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP603713 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
5 Lipoxygenase (ALOX5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]
TA806854AM 100 µL

5 Lipoxygenase (ALOX5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]

Sign In for Pricing
View Details