Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein secG (secG)

This Recombinant Probable protein-export membrane protein secG (secG) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein secG

UniProt

Q1XDL2

Expression Region

1-71

Origin

Porphyra yezoensis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQILKFFWYSSTIILIFTILIHNPKSEGLGSVGAQNQFFSNTRSTENTLNKITWLFLVL FLLLTTIIAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Actin Antibody
KC-959-01 50 μL

Beta-Actin Antibody

Sign In for Pricing
View Details
Beta-Actin Antibody
KC-959-02 100 µL

Beta-Actin Antibody

Sign In for Pricing
View Details
Beta-Actin Antibody
KC-959-03 1 mL

Beta-Actin Antibody

Sign In for Pricing
View Details
7 Chloro-Propaquizafop
TRC-C173220-50MG 50 mg

7 Chloro-Propaquizafop

Sign In for Pricing
View Details
Rerg (NM_181988) Mouse Tagged ORF Clone
MG201999 10 µg

Rerg (NM_181988) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705928 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details