Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus clausii ATP synthase subunit c (atpE)

This Recombinant Bacillus clausii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5WB73

Expression Region

1-71

Origin

Bacillus clausii (strain KSM-K16)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTELAIGIAAGLAAIGGAIGVAIIVKAVIEGTARQPEQRGTLQTLMFIGAPLAEAVPIIA IVIAFLLFFMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ZNF202 Antibody (PCRP-ZNF202-1C4) [DyLight 350]
NBP3-24003UV 0.1 mL

Mouse Monoclonal ZNF202 Antibody (PCRP-ZNF202-1C4) [DyLight 350]

Sign In for Pricing
View Details
Adamts18 (NM_001191944) Rat Tagged ORF Clone
RR217550 10 µg

Adamts18 (NM_001191944) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial
orb3010600-01 20 µg

Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial

Sign In for Pricing
View Details
Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial
orb3010600-02 100 µg

Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial

Sign In for Pricing
View Details
Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial
orb3010600-03 1 mg

Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial

Sign In for Pricing
View Details
Ctps2 (NM_001168571) Mouse Tagged ORF Clone
MR226587 10 µg

Ctps2 (NM_001168571) Mouse Tagged ORF Clone

Sign In for Pricing
View Details