Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlA homolog (ptlA)

This Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlA homolog (ptlA) spans the amino acid sequence from region 32-102.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlA homolog

UniProt

Q7WDU3

Expression Region

32-102

Origin

Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QASGGLQRVNSFMAGIVTVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIG ASAEIARYLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF594 conjugate, 0.1mg/mL
BNC940045-100 1x 100 µL

Bcl-2 (100/D5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MALT-1 (MT1/410), CF488A conjugate, 0.1mg/mL
BNC880410-500 1x 500 µL

MALT-1 (MT1/410), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details