Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine palmitoyltransferase small subunit A (SPTSSA)

This Recombinant Human Serine palmitoyltransferase small subunit A (SPTSSA) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Serine palmitoyltransferase small subunit A, Small subunit of serine palmitoyltransferase A, ssSPTa

UniProt

Q969W0

Expression Region

1-71

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI MAILHYFEIVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General 5-Hydroxytryptamine (5-HT) ELISA Kit
RDR-5-HT-Ge-01 96 Tests

General 5-Hydroxytryptamine (5-HT) ELISA Kit

Sign In for Pricing
View Details
General 5-Hydroxytryptamine (5-HT) ELISA Kit
RDR-5-HT-Ge-02 48 Tests

General 5-Hydroxytryptamine (5-HT) ELISA Kit

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), Biotin conjugate, 0.1mg/mL
BNCB1908-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NIPAL4 Human Gene Knockout Kit (CRISPR)
KN414908 1 Kit

NIPAL4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Imagabalin Hydrochloride
TRC-I721400-1MG 1 mg

Imagabalin Hydrochloride

Sign In for Pricing
View Details
5 (6) -FAM, SE [5- (and-6) -Carboxyfluorescein, succinimidyl ester] *CAS 117548-22-8*
110-AAT 25 mg

5 (6) -FAM, SE [5- (and-6) -Carboxyfluorescein, succinimidyl ester] *CAS 117548-22-8*

Sign In for Pricing
View Details