Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine palmitoyltransferase small subunit A (SPTSSA)

This Recombinant Human Serine palmitoyltransferase small subunit A (SPTSSA) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Serine palmitoyltransferase small subunit A, Small subunit of serine palmitoyltransferase A, ssSPTa

UniProt

Q969W0

Expression Region

1-71

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI MAILHYFEIVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ytterbium chloride hydrate, 99.99%
GX4544-50g 50 g

Ytterbium chloride hydrate, 99.99%

Sign In for Pricing
View Details
CRTC2 Antibody (Phospho-Ser171) : Biotin (OABF01242-Biotin)
OABF01242-Biotin 100 µL

CRTC2 Antibody (Phospho-Ser171) : Biotin (OABF01242-Biotin)

Sign In for Pricing
View Details
2-Amino-4-hydroxybenzoic acid
TRC-A636425-500MG 500 mg

2-Amino-4-hydroxybenzoic acid

Sign In for Pricing
View Details
Human Pre-screened Aortic Endothelial Cells
ABC-TC4039 1 Vial

Human Pre-screened Aortic Endothelial Cells

Sign In for Pricing
View Details
MicroLoop Assembly; box of 20 assemblies
B-M5-150-B3-R 20 Mounts/Base Assemblies

MicroLoop Assembly; box of 20 assemblies

Sign In for Pricing
View Details
Recombinant Brucella Suis BR1752 Protein (aa 1-86)
VAng-Lsx5650-50gEcoli 50 µg (E. coli)

Recombinant Brucella Suis BR1752 Protein (aa 1-86)

Sign In for Pricing
View Details