Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine palmitoyltransferase small subunit A (SPTSSA)

This Recombinant Human Serine palmitoyltransferase small subunit A (SPTSSA) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

Serine palmitoyltransferase small subunit A, Small subunit of serine palmitoyltransferase A, ssSPTa

UniProt

Q969W0

Expression Region

1-71

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI MAILHYFEIVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM86A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV642739 1.0 µg DNA

FAM86A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ELMD2 Antibody
MBS9519957-01 0.04 mL

ELMD2 Antibody

Sign In for Pricing
View Details
ELMD2 Antibody
MBS9519957-02 0.1 mL

ELMD2 Antibody

Sign In for Pricing
View Details
ELMD2 Antibody
MBS9519957-03 0.2 mL

ELMD2 Antibody

Sign In for Pricing
View Details
ELMD2 Antibody
MBS9519957-04 5x 0.2 mL

ELMD2 Antibody

Sign In for Pricing
View Details
Lentiviral human PELI3 shRNA (UAS) - Lentiviral human PELI3 shRNA (UAS, iRFP) plasmid
GTR15151660 1 Vial

Lentiviral human PELI3 shRNA (UAS) - Lentiviral human PELI3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details