Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P25966

Expression Region

1-71

Origin

Bacillus alcalophilus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLLGAAIVAGLAAVGGAIAVAIIVKSTIEGVTRQPELKGTLQTLMFIGVPLAEAVPIIA IVMGFLIMGNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2C1 / AGO1 Immunizing Peptide
MBS426350-01 0.1 mg

EIF2C1 / AGO1 Immunizing Peptide

Sign In for Pricing
View Details
EIF2C1 / AGO1 Immunizing Peptide
MBS426350-02 5x 0.1 mg

EIF2C1 / AGO1 Immunizing Peptide

Sign In for Pricing
View Details
Human Cartilage oligomeric matrix protein ELISA Kit
EK2932 Inquire

Human Cartilage oligomeric matrix protein ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD2 Antibody (BH1) [CoraFluor 1]
NBP2-34561CL1 0.1 mL

Mouse Monoclonal CD2 Antibody (BH1) [CoraFluor 1]

Sign In for Pricing
View Details
Tmem115 Mouse shRNA Lentiviral Particle (Locus ID 56395)
TL513444V 500 µL Each

Tmem115 Mouse shRNA Lentiviral Particle (Locus ID 56395)

Sign In for Pricing
View Details
ABCG2 (h) -PR
sc-41151-PR 10 µM - 20 µL

ABCG2 (h) -PR

Sign In for Pricing
View Details