Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P25966

Expression Region

1-71

Origin

Bacillus alcalophilus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLLGAAIVAGLAAVGGAIAVAIIVKSTIEGVTRQPELKGTLQTLMFIGVPLAEAVPIIA IVMGFLIMGNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Ribonuclease A Antibody [DyLight 350]
NBP3-00131UV 0.1 mL

Rabbit Polyclonal Ribonuclease A Antibody [DyLight 350]

Sign In for Pricing
View Details
Ribophorin I (RPN1) Human shRNA Plasmid Kit (Locus ID 6184)
TR309734 1 Kit

Ribophorin I (RPN1) Human shRNA Plasmid Kit (Locus ID 6184)

Sign In for Pricing
View Details
Rabbit Polyclonal DEFB132 Antibody
NBP2-92037-0.02mL 0.02 mL

Rabbit Polyclonal DEFB132 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC)
CSB-EP674965ENL-01 10 µg

Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC)

Sign In for Pricing
View Details
Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC)
CSB-EP674965ENL-02 50 µg

Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC)

Sign In for Pricing
View Details
Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC)
CSB-EP674965ENL-03 200 µg

Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC)

Sign In for Pricing
View Details