Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-71.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P26682

Expression Region

1-71

Origin

Enterococcus hirae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYIAAAIAIMGAAIGAGYGNGQVISKTIESMARQPEMSGQLRTTMFIGVALVEAVPILG VVIALILVFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone:3B11]
E45M21038 100 µg

AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone:3B11]

Sign In for Pricing
View Details
Atrial Natriuretic Peptide Receptor 2 (NPR2) Bovine ELISA Kit
B7508 96 Tests

Atrial Natriuretic Peptide Receptor 2 (NPR2) Bovine ELISA Kit

Sign In for Pricing
View Details
CRYBB3 Antibody (C-term)
MBS9213410-01 0.08 mL

CRYBB3 Antibody (C-term)

Sign In for Pricing
View Details
CRYBB3 Antibody (C-term)
MBS9213410-02 0.4 mL

CRYBB3 Antibody (C-term)

Sign In for Pricing
View Details
CRYBB3 Antibody (C-term)
MBS9213410-03 5x 0.4 mL

CRYBB3 Antibody (C-term)

Sign In for Pricing
View Details
PLC β3, phosphorylated (S1105) discontinued
341003-01 100 µL

PLC β3, phosphorylated (S1105) discontinued

Sign In for Pricing
View Details