Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Photosystem II reaction center protein H (psbH)

This Recombinant Spinacia oleracea Photosystem II reaction center protein H (psbH) spans the amino acid sequence from region 2-73.

Product Specifications

Product Name Alternative

Photosystem II reaction center protein H, PSII-H, Photosystem II 10 kDa phosphoprotein

UniProt

P05146

Expression Region

2-73

Origin

Spinacia oleracea (Spinach)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATQTVESSSRSRPKPTTVGALLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIY NSSVLLDGISMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD33 (C33/69), CF405S conjugate, 0.1mg/mL
BNC040069-500 1x 500 µL

CD33 (C33/69), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF568 conjugate, 0.1mg/mL
BNC680183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P40 (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400375-100 1x 100 µL

P40 (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF594 conjugate, 0.1mg/mL
BNC940200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (KRTL/1077), CF488A conjugate, 0.1mg/mL
BNC881077-100 1x 100 µL

Cytokeratin, LMW (KRTL/1077), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details