Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis ATP synthase subunit c (atpE)

This Recombinant Bacillus thuringiensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A0RLA0

Expression Region

1-72

Origin

Bacillus thuringiensis (strain Al Hakam)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNA3 (NM_001127384) Human Over-expression Lysate
LY426767 100 µg

CTNNA3 (NM_001127384) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CTSB (Cathepsin B) ELISA Kit
E-EL-H6151-01 24 Tests

Human CTSB (Cathepsin B) ELISA Kit

Sign In for Pricing
View Details
Human CTSB (Cathepsin B) ELISA Kit
E-EL-H6151-02 48 Tests

Human CTSB (Cathepsin B) ELISA Kit

Sign In for Pricing
View Details
Human CTSB (Cathepsin B) ELISA Kit
E-EL-H6151-03 96 Tests

Human CTSB (Cathepsin B) ELISA Kit

Sign In for Pricing
View Details
Human PSMG1 activation kit by CRISPRa
GA105710 1 Kit

Human PSMG1 activation kit by CRISPRa

Sign In for Pricing
View Details
MEKK1 (MAP3K1) pThr1383 Rabbit Polyclonal Antibody
AP12773PU-N 400 µL

MEKK1 (MAP3K1) pThr1383 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details