Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis ATP synthase subunit c (atpE)

This Recombinant Bacillus thuringiensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A0RLA0

Expression Region

1-72

Origin

Bacillus thuringiensis (strain Al Hakam)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serological Pipettes
P8270-25 150 Units/Case

Serological Pipettes

Sign In for Pricing
View Details
Azilsartan Kamedoxomil (>90%)
TRC-A965605-25MG 25 mg

Azilsartan Kamedoxomil (>90%)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left lower lobe
CS716338 5x 5 µm

Tissue FFPE Sections, Lung: left lower lobe

Sign In for Pricing
View Details
Cyanazine Amide
TRC-C953555-25MG 25 mg

Cyanazine Amide

Sign In for Pricing
View Details
10,11-Dichloro-10,11-dihydro-5H-dibenz[b,f]azepine-5-carboxamide
TRC-D434355-5G 5 g

10,11-Dichloro-10,11-dihydro-5H-dibenz[b,f]azepine-5-carboxamide

Sign In for Pricing
View Details
Mitochondrial Marker (MTC02), 1mg/mL
BNUM0740-50 1x 50 µL

Mitochondrial Marker (MTC02), 1mg/mL

Sign In for Pricing
View Details