Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis ATP synthase subunit c (atpE)

This Recombinant Bacillus thuringiensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A0RLA0

Expression Region

1-72

Origin

Bacillus thuringiensis (strain Al Hakam)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Castanospermine
SIH-529-500MG 500 mg

Castanospermine

Sign In for Pricing
View Details
Aminoacetonitrile Hydrochloride
TRC-A580055-10G 10 g

Aminoacetonitrile Hydrochloride

Sign In for Pricing
View Details
Pyridinium Chlorochromate
TRC-P991820-100G 100 g

Pyridinium Chlorochromate

Sign In for Pricing
View Details
TAP1 Human Gene Knockout Kit (CRISPR)
KN204242RB 1 Kit

TAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
beta-Formylpropionic Acid
TRC-F700935-5MG 5 mg

beta-Formylpropionic Acid

Sign In for Pricing
View Details
Recombinant Human IL-8/CXCL8 Protein (E.coli)
PKSH030277-01 20 µg

Recombinant Human IL-8/CXCL8 Protein (E.coli)

Sign In for Pricing
View Details