Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7IQW3

Expression Region

1-72

Origin

Bacillus cereus (strain G9842)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EB1 shRNA Plasmid (h)
sc-35258-SH 20 µg

EB1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Rec8 Rabbit Polyclonal Antibody
E28PT4035 100 µL

Rec8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF781 (NM_152605) Human Tagged ORF Clone Lentiviral Particle
RC211075L4V 200 µL

ZNF781 (NM_152605) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Anti Cortisol Monoclonal Antibody
DMABT-49107MC 0.2 mg

Mouse Anti Cortisol Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Arylsulfatase B
MBS9422188-01 0.02 mg

Recombinant Human Arylsulfatase B

Sign In for Pricing
View Details
Recombinant Human Arylsulfatase B
MBS9422188-02 0.1 mg

Recombinant Human Arylsulfatase B

Sign In for Pricing
View Details