Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7HFK7

Expression Region

1-72

Origin

Bacillus cereus (strain B4264)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF568 conjugate, 0.1mg/mL
BNC681423-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TEM7 (PLXDC1) activation kit by CRISPRa
GA111390 1 Kit

Human TEM7 (PLXDC1) activation kit by CRISPRa

Sign In for Pricing
View Details
MIB1 (NM_020774) Human Recombinant Protein
TP321377L 1 mg

MIB1 (NM_020774) Human Recombinant Protein

Sign In for Pricing
View Details
CD11c Recombinant Chimeric Antibody Antibody
HA601545 100 µL

CD11c Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Human ALOXE3 (Arachidonate Lipoxygenase 3) CLIA Kit
E-CL-H0333-01 24 Tests

Human ALOXE3 (Arachidonate Lipoxygenase 3) CLIA Kit

Sign In for Pricing
View Details
Human ALOXE3 (Arachidonate Lipoxygenase 3) CLIA Kit
E-CL-H0333-02 48 Tests

Human ALOXE3 (Arachidonate Lipoxygenase 3) CLIA Kit

Sign In for Pricing
View Details