Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7HFK7

Expression Region

1-72

Origin

Bacillus cereus (strain B4264)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary
CR560448 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF405S conjugate, 0.1mg/mL
BNC042342-100 1x 100 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (FABP5/3750), CF594 conjugate, 0.1mg/mL
BNC943750-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (FABP5/3750), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vmn2r55 Mouse Gene Knockout Kit (CRISPR)
KN519185 1 Kit

Vmn2r55 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIB2 Polyclonal Antibody
E-AB-17148-01 20 µL

TRIB2 Polyclonal Antibody

Sign In for Pricing
View Details
TRIB2 Polyclonal Antibody
E-AB-17148-02 60 µL

TRIB2 Polyclonal Antibody

Sign In for Pricing
View Details