Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B9IRU2

Expression Region

1-72

Origin

Bacillus cereus (strain Q1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HINT1 Antibody
RC-5742-01 50 μL

Recombinant HINT1 Antibody

Sign In for Pricing
View Details
Recombinant HINT1 Antibody
RC-5742-02 100 µL

Recombinant HINT1 Antibody

Sign In for Pricing
View Details
Recombinant HINT1 Antibody
RC-5742-03 1 mL

Recombinant HINT1 Antibody

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF640R conjugate, 0.1mg/mL
BNC400416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF405S conjugate, 0.1mg/mL
BNC040172-100 1x 100 µL

CD45 / LCA (135-4C5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IMPA2 (NM_014214) Human Recombinant Protein
TP720526 10 µg

IMPA2 (NM_014214) Human Recombinant Protein

Sign In for Pricing
View Details