Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis ATP synthase subunit c (atpE)

This Recombinant Bacillus anthracis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C3LFI4

Expression Region

1-72

Origin

Bacillus anthracis (strain CDC 684 / NRRL 3495)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF9 Polyclonal Antibody, PE-Cy7 Conjugated
bs-3851R-PE-Cy7 100 µL

TNFSF9 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Test Tube Rack 30 x 18-21mm Tubes - EACH
SHA4460 1 Each

Test Tube Rack 30 x 18-21mm Tubes - EACH

Sign In for Pricing
View Details
LGI2 CRISPR Activation Plasmid (m2)
sc-434215-ACT-2 20 µg

LGI2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
DSS1, NT (26S Proteasome Complex Subunit DSS1, Split Hand/Foot Malformation Type 1 Protein, Deleted In Split Hand/Split Foot Protein 1, Split Hand/Foot Deleted Protein 1, SHFM1, SHFDG1) (Azide free) (HRP)
MBS6473026-01 0.2 mL

DSS1, NT (26S Proteasome Complex Subunit DSS1, Split Hand/Foot Malformation Type 1 Protein, Deleted In Split Hand/Split Foot Protein 1, Split Hand/Foot Deleted Protein 1, SHFM1, SHFDG1) (Azide free) (HRP)

Sign In for Pricing
View Details
DSS1, NT (26S Proteasome Complex Subunit DSS1, Split Hand/Foot Malformation Type 1 Protein, Deleted In Split Hand/Split Foot Protein 1, Split Hand/Foot Deleted Protein 1, SHFM1, SHFDG1) (Azide free) (HRP)
MBS6473026-02 5x 0.2 mL

DSS1, NT (26S Proteasome Complex Subunit DSS1, Split Hand/Foot Malformation Type 1 Protein, Deleted In Split Hand/Split Foot Protein 1, Split Hand/Foot Deleted Protein 1, SHFM1, SHFDG1) (Azide free) (HRP)

Sign In for Pricing
View Details
2-Amino-3- (6-hydroxypyridin-3-yl) propanoic acid dihydrochloride
MRD25990-01 50 mg

2-Amino-3- (6-hydroxypyridin-3-yl) propanoic acid dihydrochloride

Sign In for Pricing
View Details