Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis ATP synthase subunit c (atpE)

This Recombinant Bacillus anthracis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C3LFI4

Expression Region

1-72

Origin

Bacillus anthracis (strain CDC 684 / NRRL 3495)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KICS2 Human siRNA Oligo Duplex (Locus ID 144577)
SR315487 1 Kit

KICS2 Human siRNA Oligo Duplex (Locus ID 144577)

Sign In for Pricing
View Details
GDNF Antibody: RPE
MBS8006043-01 0.1 mg

GDNF Antibody: RPE

Sign In for Pricing
View Details
GDNF Antibody: RPE
MBS8006043-02 5x 0.1 mg

GDNF Antibody: RPE

Sign In for Pricing
View Details
METTL25 Antibody, FITC conjugated
CSB-PA839813LC01HU-01 50 µg

METTL25 Antibody, FITC conjugated

Sign In for Pricing
View Details
METTL25 Antibody, FITC conjugated
CSB-PA839813LC01HU-02 100 µg

METTL25 Antibody, FITC conjugated

Sign In for Pricing
View Details
P-Dynamin I (F-11) FITC
sc-377568 FITC 200 µg/mL

P-Dynamin I (F-11) FITC

Sign In for Pricing
View Details