Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis ATP synthase subunit c (atpE)

This Recombinant Bacillus anthracis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C3P1F9

Expression Region

1-72

Origin

Bacillus anthracis (strain A0248)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNBD1 Human Gene Knockout Kit (CRISPR)
KN421848 1 Kit

CNBD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS645491 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
GMFG (NM_004877) Human Over-expression Lysate
LY401523 100 µg

GMFG (NM_004877) Human Over-expression Lysate

Sign In for Pricing
View Details
VB6 (Vitamin B6) ELISA Kit
E-EL-0008-01 24 Tests

VB6 (Vitamin B6) ELISA Kit

Sign In for Pricing
View Details
VB6 (Vitamin B6) ELISA Kit
E-EL-0008-02 48 Tests

VB6 (Vitamin B6) ELISA Kit

Sign In for Pricing
View Details
VB6 (Vitamin B6) ELISA Kit
E-EL-0008-03 96 Tests

VB6 (Vitamin B6) ELISA Kit

Sign In for Pricing
View Details