Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis ATP synthase subunit c (atpE)

This Recombinant Bacillus anthracis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C3P1F9

Expression Region

1-72

Origin

Bacillus anthracis (strain A0248)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCN2 Mouse Monoclonal Antibody [Clone ID: OTI2G3]
CF806801 100 µg

CCN2 Mouse Monoclonal Antibody [Clone ID: OTI2G3]

Sign In for Pricing
View Details
NOLA1 (GAR1) Rabbit Polyclonal Antibody
TA369636 100 µL

NOLA1 (GAR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL-17A Antibody Pair Set
E-KAB-0082 50 µL & 100 µg

Mouse IL-17A Antibody Pair Set

Sign In for Pricing
View Details
LRRC20 (NM_001278214) Human Tagged ORF Clone
RG235722 10 µg

LRRC20 (NM_001278214) Human Tagged ORF Clone

Sign In for Pricing
View Details
EGLN1 / PHD2 (366G/76/3), CF740 conjugate, 0.1mg/mL
BNC743074-100 1x 100 µL

EGLN1 / PHD2 (366G/76/3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A Recombinant Rabbit Monoclonal Antibody [JM103-7]
ET1703-08 100 µL

Chromogranin A Recombinant Rabbit Monoclonal Antibody [JM103-7]

Sign In for Pricing
View Details