Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis ATP synthase subunit c (atpE)

This Recombinant Bacillus anthracis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C3P1F9

Expression Region

1-72

Origin

Bacillus anthracis (strain A0248)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-)-N-Boc-D-Alpha-phenylglycinol
TRC-B689770-250MG 250 mg

(-)-N-Boc-D-Alpha-phenylglycinol

Sign In for Pricing
View Details
BCAT2 (C-term) Rabbit Polyclonal Antibody
AP50351PU-N 400 µL

BCAT2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPRC5C (NM_022036) Human Over-expression Lysate
LC402899 20 µg

GPRC5C (NM_022036) Human Over-expression Lysate

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF488A conjugate, 0.1mg/mL
BNC881779-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate
LC400972 20 µg

JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate

Sign In for Pricing
View Details
BSA Mouse Monoclonal Antibody [2-B8]
M0809-3 100 µL

BSA Mouse Monoclonal Antibody [2-B8]

Sign In for Pricing
View Details