Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Syntrophomonas wolfei subsp. wolfei ATP synthase subunit c (atpE)

This Recombinant Syntrophomonas wolfei subsp. wolfei ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0AUC8

Expression Region

1-72

Origin

Syntrophomonas wolfei subsp. wolfei (strain Goettingen)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVALGAGLAVSIAGIGGGIGMGIAGGKAFEAIARQPEVGGDVRTLLFITLAFIETLTIY GLLIAFMLVGKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1543 (CAMSAP3) Rabbit Polyclonal Antibody
TA372864 100 µL

KIAA1543 (CAMSAP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)
PKSH032598-01 10 µg

Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)
PKSH032598-02 50 µg

Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)

Sign In for Pricing
View Details
Human C12orf40 activation kit by CRISPRa
GA117029 1 Kit

Human C12orf40 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ATP13A4 activation kit by CRISPRa
GA113441 1 Kit

Human ATP13A4 activation kit by CRISPRa

Sign In for Pricing
View Details
tert-Butyl 6-Hydroxy-2-azaspiro[3.3]heptane-2-carboxylate
TRC-B809463-2.5G 2.5 g

tert-Butyl 6-Hydroxy-2-azaspiro[3.3]heptane-2-carboxylate

Sign In for Pricing
View Details