Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens ATP synthase subunit c (atpE)

This Recombinant Clostridium perfringens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0TNB9

Expression Region

1-72

Origin

Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMKLLAAGIAVLAGIGAGIGIGIATAGALEATARQPEASDKIQSLFIMGAGLSEATAIY GLVVSIILLFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella mdh Protein (aa 1-283)
VAng-Wyb1130-1mgEcoli 1 mg (E. coli)

Recombinant Salmonella mdh Protein (aa 1-283)

Sign In for Pricing
View Details
Rabbit Polyclonal SATB2 Antibody [CoraFluor 1]
NBP1-76913CL1 0.1 mL

Rabbit Polyclonal SATB2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Human p21-Activated Kinase 4 (PAK-4) AssayLite™ Antibody (PerCP Conjugate)
33122-05171 5x 30 µg

Human p21-Activated Kinase 4 (PAK-4) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
Ranevetmab
E40YR1439 1 mg

Ranevetmab

Sign In for Pricing
View Details
SF3A1 Human Recombinant Protein
TP725111 50 µg

SF3A1 Human Recombinant Protein

Sign In for Pricing
View Details
HEXA Rabbit Polyclonal Antibody (Fluoro594)
orb3081797 100 µg

HEXA Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details