Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens ATP synthase subunit c (atpE)

This Recombinant Clostridium perfringens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0TNB9

Expression Region

1-72

Origin

Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMKLLAAGIAVLAGIGAGIGIGIATAGALEATARQPEASDKIQSLFIMGAGLSEATAIY GLVVSIILLFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a20 Mouse shRNA Lentiviral Particle (Locus ID 381203)
TL508582V 500 µL Each

Slc22a20 Mouse shRNA Lentiviral Particle (Locus ID 381203)

Sign In for Pricing
View Details
MLLT10 CRISPRa sgRNA lentivector (set of three targets)(Human)
30203121 3x 1.0µg DNA

MLLT10 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TNXB (NM_032470) Human Over-expression Lysate
LS007148-100ug 100 µg

TNXB (NM_032470) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal XPF Antibody (OTI4E11) [mFluor Violet 500 SE]
NBP2-74883MFV500 0.1 mL

Mouse Monoclonal XPF Antibody (OTI4E11) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
ent-Calindol Amide-13C
TRC-C148653-2.5MG 2.5 mg

ent-Calindol Amide-13C

Sign In for Pricing
View Details
F13b siRNA Oligos set (Mouse)
19611174 3x 5 nmol

F13b siRNA Oligos set (Mouse)

Sign In for Pricing
View Details