Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens ATP synthase subunit c (atpE)

This Recombinant Clostridium perfringens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0TNB9

Expression Region

1-72

Origin

Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMKLLAAGIAVLAGIGAGIGIGIATAGALEATARQPEASDKIQSLFIMGAGLSEATAIY GLVVSIILLFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Mab21 Domain Containing Protein 1 (MB21D1)
RPU53315-01 50 µg

Recombinant Human Mab21 Domain Containing Protein 1 (MB21D1)

Sign In for Pricing
View Details
Recombinant Human Mab21 Domain Containing Protein 1 (MB21D1)
RPU53315-02 100 µg

Recombinant Human Mab21 Domain Containing Protein 1 (MB21D1)

Sign In for Pricing
View Details
Recombinant Human Mab21 Domain Containing Protein 1 (MB21D1)
RPU53315-03 1 mg

Recombinant Human Mab21 Domain Containing Protein 1 (MB21D1)

Sign In for Pricing
View Details
Chicken Putative Uncharacterized Protein C8orf77 (C8ORF77) ELISA Kit
MBS9946501 Inquire

Chicken Putative Uncharacterized Protein C8orf77 (C8ORF77) ELISA Kit

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit b (atpF), partial
MBS7053900 Inquire

Recombinant Streptococcus pneumoniae ATP synthase subunit b (atpF), partial

Sign In for Pricing
View Details
KIF24 Polyclonal Antibody, HRP Conjugated
A65179-050 50 µL

KIF24 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details