Recombinant Clostridium perfringens ATP synthase subunit c (atpE)
This Recombinant Clostridium perfringens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q0TNB9
Expression Region
1-72
Origin
Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDMKLLAAGIAVLAGIGAGIGIGIATAGALEATARQPEASDKIQSLFIMGAGLSEATAIY GLVVSIILLFVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OKAG02113 2x 96 Well
Phospho-FER (Tyr402) Colorimetric Cell-Based ELISA Kit (OKAG02113)
Sign In for Pricing
View Details 
MBS6381228-01 0.1 mL
HLA-DMA (HLA Class II Histocompatibility Antigen, DM alpha Chain, MHC Class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) (MaxLight 550)
Sign In for Pricing
View Details MBS6381228-02 5x 0.1 mL
HLA-DMA (HLA Class II Histocompatibility Antigen, DM alpha Chain, MHC Class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) (MaxLight 550)
Sign In for Pricing
View Details 
NBP2-98631UV 0.1 mL
Rabbit Polyclonal SLC45A4 Antibody [DyLight 350]
Sign In for Pricing
View Details