Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0292940 (DDB_G0292940)

This Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0292940 (DDB_G0292940) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

Putative uncharacterized protein DDB_G0292940

UniProt

Q54CM6

Expression Region

1-72

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIFFINTPTPPNIFFSKNIKIKKLMRFSCTEVCIFFSLIFFFFFFFFCVNWGCENNLLS RKYQMNRDTCNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details