Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q630T8

Expression Region

1-72

Origin

Bacillus cereus (strain ZK / E33L)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD52 Antibody
MBS7122320-01 0.05 mg

RAD52 Antibody

Sign In for Pricing
View Details
RAD52 Antibody
MBS7122320-02 0.1 mg

RAD52 Antibody

Sign In for Pricing
View Details
RAD52 Antibody
MBS7122320-03 5x 0.1 mg

RAD52 Antibody

Sign In for Pricing
View Details
BLOT-LINE ANA (Autoimmune Immunoblot Kit) [CE]
ANAL20 20 Tests

BLOT-LINE ANA (Autoimmune Immunoblot Kit) [CE]

Sign In for Pricing
View Details
Mouse Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit
DL-VCAM1-Mu-01 48 Tests

Mouse Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit
DL-VCAM1-Mu-02 96 Tests

Mouse Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit

Sign In for Pricing
View Details