Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q630T8

Expression Region

1-72

Origin

Bacillus cereus (strain ZK / E33L)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-AAV8 (intact particle) Monoclonal antibody, clone BEL9
DPAB1439 100 μg

Human Anti-AAV8 (intact particle) Monoclonal antibody, clone BEL9

Sign In for Pricing
View Details
Claudin-16 (CLDN16) discontinued
301615 100 µg

Claudin-16 (CLDN16) discontinued

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD4 Antibody
RD21331F-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD4 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD4 Antibody
RD21331F-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD4 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD4 Antibody
RD21331F-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD4 Antibody

Sign In for Pricing
View Details
PSMB10 Recombinant Antibody
bsm-62964R-TR 20 µL

PSMB10 Recombinant Antibody

Sign In for Pricing
View Details