Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian ATP synthase subunit c (atpE)

This Recombinant Bacillus thuringiensis subsp. konkukian ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6HAX4

Expression Region

1-72

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken FBF1 ELISA Kit
EF012300 96 Tests

Chicken FBF1 ELISA Kit

Sign In for Pricing
View Details
PLV3-U6-NSD2-shRNA3-CopGFP-Puro Plasmid
PVT81187 2 µg

PLV3-U6-NSD2-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
STEAP4 Rabbit Polyclonal Antibody
TA324150 100 µL

STEAP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)
MBS2062157-01 0.1 mL

APC-Linked Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)
MBS2062157-02 0.2 mL

APC-Linked Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)
MBS2062157-03 0.5 mL

APC-Linked Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)

Sign In for Pricing
View Details