Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q72XE3

Expression Region

1-72

Origin

Bacillus cereus (strain ATCC 10987)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHIT (Fragile Histidine Triad Gene, AP3Aase, FRA3B) (MaxLight 490)
MBS6206192-01 0.1 mL

FHIT (Fragile Histidine Triad Gene, AP3Aase, FRA3B) (MaxLight 490)

Sign In for Pricing
View Details
FHIT (Fragile Histidine Triad Gene, AP3Aase, FRA3B) (MaxLight 490)
MBS6206192-02 5x 0.1 mL

FHIT (Fragile Histidine Triad Gene, AP3Aase, FRA3B) (MaxLight 490)

Sign In for Pricing
View Details
Ghrelin (1-18) free acid (Human)
031-75 100 µg

Ghrelin (1-18) free acid (Human)

Sign In for Pricing
View Details
6-Hydroxyhexanoic acid
HY-W105750-01 500 mg

6-Hydroxyhexanoic acid

Sign In for Pricing
View Details
6-Hydroxyhexanoic acid
HY-W105750-02 1 g

6-Hydroxyhexanoic acid

Sign In for Pricing
View Details
6-Hydroxyhexanoic acid
HY-W105750-03 5 g

6-Hydroxyhexanoic acid

Sign In for Pricing
View Details