Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q72XE3

Expression Region

1-72

Origin

Bacillus cereus (strain ATCC 10987)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNP (NM_024877) Human Untagged Clone
SC327785 10 µg

CCNP (NM_024877) Human Untagged Clone

Sign In for Pricing
View Details
BAP31 (B Cell Receptor-associated Protein 31, BCR-associated Protein BAP31, BCAP31, 6C6-AG Tumor-associated Antigen, Accessory Protein BAP31, DXS1357E, p28 Bap31, Protein CDM) (MaxLight 405) discontinued
B0077-01A-ML405 100 µL

BAP31 (B Cell Receptor-associated Protein 31, BCR-associated Protein BAP31, BCAP31, 6C6-AG Tumor-associated Antigen, Accessory Protein BAP31, DXS1357E, p28 Bap31, Protein CDM) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal EphB4 Antibody (H1) [FITC]
NBP2-89355F 0.1 mL

Rabbit Monoclonal EphB4 Antibody (H1) [FITC]

Sign In for Pricing
View Details
GPCR modulator-1
HY-124803-01 1 mg

GPCR modulator-1

Sign In for Pricing
View Details
GPCR modulator-1
HY-124803-02 5 mg

GPCR modulator-1

Sign In for Pricing
View Details
GPCR modulator-1
HY-124803-03 10 mg

GPCR modulator-1

Sign In for Pricing
View Details