Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q72XE3

Expression Region

1-72

Origin

Bacillus cereus (strain ATCC 10987)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPY19L4 AAV Vector (Mouse) (CMV)
18576104 1 µg

DPY19L4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
RBM4B sgRNA CRISPR Lentivector (Human) (Target 1)
K1792502 1.0 µg DNA

RBM4B sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Porcine Ubiquitin like modifier activating enzyme ATG7 (ATG7) ELISA kit
GTR10403142 96 Well

Porcine Ubiquitin like modifier activating enzyme ATG7 (ATG7) ELISA kit

Sign In for Pricing
View Details
Cytokeratin 20 (ABT-Ck20) Mouse mAb
MBS8541232-01 0.1 mL

Cytokeratin 20 (ABT-Ck20) Mouse mAb

Sign In for Pricing
View Details
Cytokeratin 20 (ABT-Ck20) Mouse mAb
MBS8541232-02 0.1 mL (AF405L)

Cytokeratin 20 (ABT-Ck20) Mouse mAb

Sign In for Pricing
View Details
Cytokeratin 20 (ABT-Ck20) Mouse mAb
MBS8541232-03 0.1 mL (AF405S)

Cytokeratin 20 (ABT-Ck20) Mouse mAb

Sign In for Pricing
View Details