Recombinant Ashbya gossypii V-type proton ATPase subunit e (VMA9)
This Recombinant Ashbya gossypii V-type proton ATPase subunit e (VMA9) spans the amino acid sequence from region 1-72.
Product Specifications
Product Name Alternative
V-type proton ATPase subunit e, V-ATPase subunit e, Vacuolar proton pump subunit e
UniProt
Q75EU0
Expression Region
1-72
Origin
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSFYTVVATFLSVVLASAVFWVLAPKENQTVWRSTIILSMSMMFLMWAVTYLSQLHPLVV PRRSDLRPEFAE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1017095 Inquire
Recombinant Brucella ovis ATP synthase subunit b 1 (atpF1)
Sign In for Pricing
View Details 
K0372305 3x 1.0 µg
CCAR1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 