Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii V-type proton ATPase subunit e (VMA9)

This Recombinant Ashbya gossypii V-type proton ATPase subunit e (VMA9) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e, V-ATPase subunit e, Vacuolar proton pump subunit e

UniProt

Q75EU0

Expression Region

1-72

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFYTVVATFLSVVLASAVFWVLAPKENQTVWRSTIILSMSMMFLMWAVTYLSQLHPLVV PRRSDLRPEFAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to MSLN
E10-31811 100 µL

Mouse Monoclonal Antibody to MSLN

Sign In for Pricing
View Details
Recombinant Mouse HMX1 Protein, His (Fc)-Avi-tagged
HMX1-4250M 50 µg

Recombinant Mouse HMX1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PCNT Polyclonal Antibody
UB-GEN-7657 100 µL

PCNT Polyclonal Antibody

Sign In for Pricing
View Details
Easypro Mouse Tenascin X (TNX) ELISA Kit
FY-EM1823S 96 Well

Easypro Mouse Tenascin X (TNX) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig 18-Hydroxycorticosterone ELISA Kit
MBS7279764-01 48 Well

Guinea Pig 18-Hydroxycorticosterone ELISA Kit

Sign In for Pricing
View Details
Guinea Pig 18-Hydroxycorticosterone ELISA Kit
MBS7279764-02 96 Well

Guinea Pig 18-Hydroxycorticosterone ELISA Kit

Sign In for Pricing
View Details