Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q81JZ0

Expression Region

1-72

Origin

Bacillus anthracis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD532 acid
1795-AAT 10 mg

XFD532 acid

Sign In for Pricing
View Details
ADH5 (NM_000671) Human Recombinant Protein
TP304903L 1 mg

ADH5 (NM_000671) Human Recombinant Protein

Sign In for Pricing
View Details
KLF6 (NM_001300) Human Over-expression Lysate
LC400520 20 µg

KLF6 (NM_001300) Human Over-expression Lysate

Sign In for Pricing
View Details
IL-1RA Recombinant Rabbit Monoclonal Antibody [JE07-58]
HA722446 100 µL

IL-1RA Recombinant Rabbit Monoclonal Antibody [JE07-58]

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF640R conjugate, 0.1mg/mL
BNC402346-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB525792 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details