Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q81JZ0

Expression Region

1-72

Origin

Bacillus anthracis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), 0.2mg/mL
BNUB2751-100 1x 100 µL

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), 0.2mg/mL

Sign In for Pricing
View Details
Sh2d5 Mouse Gene Knockout Kit (CRISPR)
KN515706 1 Kit

Sh2d5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Rabbit Polyclonal Antibody
ER1802-39 100 µL

APC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]
TA805898AM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806056 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
FGFR1 Human Gene Knockout Kit (CRISPR)
KN402080 1 Kit

FGFR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details