Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q81JZ0

Expression Region

1-72

Origin

Bacillus anthracis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB3 Human Gene Knockout Kit (CRISPR)
KN401296 1 Kit

PSMB3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE3C (NM_014671) Human Recombinant Protein
TP315110M 100 µg

UBE3C (NM_014671) Human Recombinant Protein

Sign In for Pricing
View Details
Doxylamine N'-Oxide
TRC-D562030-100MG 100 mg

Doxylamine N'-Oxide

Sign In for Pricing
View Details
ARMC8 Polyclonal Antibody
E-AB-18698-01 20 µL

ARMC8 Polyclonal Antibody

Sign In for Pricing
View Details
ARMC8 Polyclonal Antibody
E-AB-18698-02 60 µL

ARMC8 Polyclonal Antibody

Sign In for Pricing
View Details
ARMC8 Polyclonal Antibody
E-AB-18698-03 120 µL

ARMC8 Polyclonal Antibody

Sign In for Pricing
View Details