Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Dolichol phosphate-mannose biosynthesis regulatory protein (dpm2)

This Recombinant Schizosaccharomyces pombe Dolichol phosphate-mannose biosynthesis regulatory protein (dpm2) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

Dolichol phosphate-mannose biosynthesis regulatory protein

UniProt

Q9USW6

Expression Region

1-72

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVYISTAAFLYYTIWVLIMPFVDNMNISQKLFLDREWAITIPVAVMLFGICLIGTFVSL LMIKSSKKKSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHLHA15 (BHLHB8, MIST1, Class A Basic Helix-loop-helix Protein 15, Class B Basic Helix-loop-helix Protein 8, Muscle, Intestine and Stomach Expression 1) (PE)
MBS6156731-01 0.1 mL

BHLHA15 (BHLHB8, MIST1, Class A Basic Helix-loop-helix Protein 15, Class B Basic Helix-loop-helix Protein 8, Muscle, Intestine and Stomach Expression 1) (PE)

Sign In for Pricing
View Details
BHLHA15 (BHLHB8, MIST1, Class A Basic Helix-loop-helix Protein 15, Class B Basic Helix-loop-helix Protein 8, Muscle, Intestine and Stomach Expression 1) (PE)
MBS6156731-02 5x 0.1 mL

BHLHA15 (BHLHB8, MIST1, Class A Basic Helix-loop-helix Protein 15, Class B Basic Helix-loop-helix Protein 8, Muscle, Intestine and Stomach Expression 1) (PE)

Sign In for Pricing
View Details
Peroxin 2 Polyclonal Antibody
orb1412548 100 µL

Peroxin 2 Polyclonal Antibody

Sign In for Pricing
View Details
Spacer C3 Internal 200 nmol scale
26-6439N-02 1 Each

Spacer C3 Internal 200 nmol scale

Sign In for Pricing
View Details
LYSMD4 Protein Vector (Mouse) (pPM-C-His)
PV198425 500 ng

LYSMD4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Factor VIII Polyclonal Antibody, Cy7 Conjugated
bs-0332R-Cy7 100 µL

Factor VIII Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details