Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Metridium senile ATP synthase protein 8 (MTATP8)

This Recombinant Metridium senile ATP synthase protein 8 (MTATP8) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase protein 8, A6L, F-ATPase subunit 8

UniProt

O47493

Expression Region

1-72

Origin

Metridium senile (Brown sea anemone) (Frilled sea anemone)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMPQLETATYLTQYRWTLIALFLLFSFLVVSVLPAVKTNFLIRRSIGAGWTGAPKTSDLN KGPASLWSWDKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-100 1x 100 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-100 1x 100 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF568 conjugate, 0.1mg/mL
BNC680968-100 1x 100 µL

CD63 (LAMP3/968), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL
BNC042311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL
BNC040795-100 1x 100 µL

CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details